KIAA0319 Antikörper (N-Term)

Produktnummer ABIN630311

Produktdetails anti-KIAA0319 Antikörper

Target: KIAA0319

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KIAA0319 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: KIAA0319 antibody was raised against the N terminal of KIAA0319

Aufreinigung: Purified

Immunogen: KIAA0319 antibody was raised using the N terminal of KIAA0319 corresponding to a region with amino acids EEMSEYSDDYRELEKDLLQPSGKQEPRGSAEYTDWGLLPGSEGAFNSSVG

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KIAA0319 Blocking Peptide, catalog no. 33R-2376, is also available for use as a blocking control in assays to test for specificity of this KIAA0319 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIAA0319 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KIAA0319

Target: KIAA0319

Andere Bezeichnung: KIAA0319 (KIAA0319 Produkte)

Synonyme: DYLX2 antikoerper, DYX2 antikoerper, 4930451E12Rik antikoerper, Kiaa0319 antikoerper, KIAA0319 antikoerper, RIKEN cDNA D130043K22 gene antikoerper, KIAA0319 ortholog antikoerper, similar to mKIAA0319 protein antikoerper, KIAA0319 antikoerper, D130043K22Rik antikoerper, RGD1307443 antikoerper

Hintergrund: KIAA0319 has been strongly associated with developmental dyslexia.

Molekulargewicht: 56 kDa (MW of target protein)