KIAA0319 Antikörper (N-Term)
Kurzübersicht für KIAA0319 Antikörper (N-Term) (ABIN630311)
Target
Alle KIAA0319 Antikörper anzeigenReaktivität
Wirt
Klonalität
Konjugat
Applikation
-
-
Bindungsspezifität
- N-Term
-
Spezifität
- KIAA0319 antibody was raised against the N terminal of KIAA0319
-
Aufreinigung
- Purified
-
Immunogen
- KIAA0319 antibody was raised using the N terminal of KIAA0319 corresponding to a region with amino acids EEMSEYSDDYRELEKDLLQPSGKQEPRGSAEYTDWGLLPGSEGAFNSSVG
-
-
-
-
Applikationshinweise
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. -
Kommentare
-
KIAA0319 Blocking Peptide, (ABIN937762), is also available for use as a blocking control in assays to test for specificity of this KIAA0319 antibody
-
Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
-
-
Format
- Lyophilized
-
Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIAA0319 antibody in PBS
-
Konzentration
- Lot specific
-
Buffer
- PBS
-
Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. -
Lagerung
- 4 °C/-20 °C
-
Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
- KIAA0319
-
Andere Bezeichnung
- KIAA0319
-
Hintergrund
- KIAA0319 has been strongly associated with developmental dyslexia.
-
Molekulargewicht
- 56 kDa (MW of target protein)
Target
-