SC4MOL Antikörper (N-Term)

Produktnummer ABIN630307

Produktdetails anti-SC4MOL Antikörper

Target: SC4MOL (MSMO1) (Methylsterol Monooxygenase 1 (MSMO1))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SC4MOL Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SC4 MOL antibody was raised against the N terminal of SC4 OL

Aufreinigung: Purified

Immunogen: SC4 MOL antibody was raised using the N terminal of SC4 OL corresponding to a region with amino acids MATNESVSIFSSASLAVEYVDSLLPENPLQEPFKNAWNYMLNNYTKFQIA

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SC4MOL Blocking Peptide, catalog no. 33R-5780, is also available for use as a blocking control in assays to test for specificity of this SC4MOL antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SC0 OL antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SC4MOL

Target: SC4MOL (MSMO1) (Methylsterol Monooxygenase 1 (MSMO1))

Andere Bezeichnung: SC4MOL (MSMO1 Produkte)

Synonyme: sc4mol antikoerper, wu:fb59g06 antikoerper, wu:fb66e06 antikoerper, zgc:56437 antikoerper, DESP4 antikoerper, ERG25 antikoerper, SC4MOL antikoerper, Sc4mol antikoerper, 1500001G16Rik antikoerper, C78600 antikoerper, Msmo1 antikoerper, methylsterol monooxygenase 1 antikoerper, methylsterol monoxygenase 1 antikoerper, msmo1 antikoerper, MSMO1 antikoerper, Msmo1 antikoerper

Hintergrund: Sterol-C4-mehtyl oxidase-like protein was isolated based on its similarity to the yeast ERG25 protein. It contains a set of putative metal binding motifs with similarity to that seen in a family of membrane desaturases-hydroxylases.

Molekulargewicht: 35 kDa (MW of target protein)