ZFYVE27 Antikörper (C-Term)

Produktnummer ABIN630303

Der Kaninchen Polyklonal anti-ZFYVE27 Antikörper (ABIN630303) detektiert spezifisch ZFYVE27 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human, Ratte, Hund und Zebrafisch (Danio rerio).

Kurzübersicht für ZFYVE27 Antikörper (C-Term) (ABIN630303)

Target: ZFYVE27 (Zinc Finger, FYVE Domain Containing 27 (ZFYVE27))

Reaktivität: Human, Ratte, Hund, Zebrafisch (Danio rerio)

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ZFYVE27 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ZFYVE27 Antikörper

Bindungsspezifität: C-Term

Spezifität: ZFYVE27 antibody was raised against the C terminal of ZFYVE27

Aufreinigung: Purified

Immunogen: ZFYVE27 antibody was raised using the C terminal of ZFYVE27 corresponding to a region with amino acids TFSVLKKRRSCSNCGNSFCSRCCSFKVPKSSMGATAPEAQRETVFVCASC

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ZFYVE27 Blocking Peptide, (ABIN5617112), is also available for use as a blocking control in assays to test for specificity of this ZFYVE27 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZFYVE27 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ZFYVE27

Target: ZFYVE27 (Zinc Finger, FYVE Domain Containing 27 (ZFYVE27))

Andere Bezeichnung: ZFYVE27

Hintergrund: ZFYVE27 may be associated with the neuronal intracellular trafficking in the corticospinal tract, which is consistent with the pathology of HSP.

Molekulargewicht: 46 kDa (MW of target protein)

Pathways: Neurotrophin Signalübertragung