RARRES3 Antikörper

Produktnummer ABIN630298

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch RARRES3 in WB und IHC. Es zeigt Reaktivität gegenüber Proben von Human.

Kurzübersicht für RARRES3 Antikörper (ABIN630298)

Target: RARRES3 (Retinoic Acid Receptor Responder (Tazarotene Induced) 3 (RARRES3))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RARRES3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-RARRES3 Antikörper

Aufreinigung: Purified

Immunogen: RARRES3 antibody was raised using a synthetic peptide corresponding to a region with amino acids FSVLSNSAEVKRERLEDVVGGCCYRVNNSLDHEYQPRPVEVIISSAKEMV

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RARRES3 Blocking Peptide, (ABIN938468), is also available for use as a blocking control in assays to test for specificity of this RARRES3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RARRES3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RARRES3

Target: RARRES3 (Retinoic Acid Receptor Responder (Tazarotene Induced) 3 (RARRES3))

Andere Bezeichnung: RARRES3

Hintergrund: Retinoids exert biologic effects such as potent growth inhibitory and cell differentiation activities and are used in the treatment of hyperproliferative dermatological diseases. These effects are mediated by specific nuclear receptor proteins that are members of the steroid and thyroid hormone receptor superfamily of transcriptional regulators. RARRES3 is thought act as a tumor suppressor or growth regulator.

Molekulargewicht: 18 kDa (MW of target protein)