Occludin Antikörper (N-Term)
-
- Target Alle Occludin (OCLN) Antikörper anzeigen
- Occludin (OCLN)
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Occludin Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Occludin antibody was raised against the N terminal of OCLN
- Aufreinigung
- Purified
- Immunogen
- Occludin antibody was raised using the N terminal of OCLN corresponding to a region with amino acids MSSRPLESPPPYRPDEFKPNHYAPSNDIYGGEMHVRPMLSQPAYSFYPED
- Top Product
- Discover our top product OCLN Primärantikörper
-
-
- Applikationshinweise
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Occludin Blocking Peptide, catalog no. 33R-6508, is also available for use as a blocking control in assays to test for specificity of this Occludin antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OCLN antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Occludin (OCLN)
- Andere Bezeichnung
- Occludin (OCLN Produkte)
- Synonyme
- AI503564 antikoerper, Ocl antikoerper, ocln antikoerper, oclnb antikoerper, tpmt antikoerper, OCLN antikoerper, wu:fd23h10 antikoerper, wu:fi13c01 antikoerper, zgc:113992 antikoerper, zgc:56359 antikoerper, BLCPMG antikoerper, occludin antikoerper, occludin S homeolog antikoerper, occludin a antikoerper, Ocln antikoerper, OCLN antikoerper, ocln.S antikoerper, ocln antikoerper, oclna antikoerper
- Hintergrund
- OCLN is an integral membrane protein which is located at tight junctions. This protein may be involved in the formation and maintenance of the tight junction. The possibility of several alternatively spliced products has been suggested but the full nature of these products has not been described.
- Molekulargewicht
- 59 kDa (MW of target protein)
- Pathways
- Cell-Cell Junction Organization, Hepatitis C
-