SLC39A6 Antikörper

Produktnummer ABIN630293

Produktdetails anti-SLC39A6 Antikörper

Target: SLC39A6 (Solute Carrier Family 39 (Zinc Transporter), Member 6 (SLC39A6))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC39A6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Aufreinigung: Purified

Immunogen: SLC39 A6 antibody was raised using a synthetic peptide corresponding to a region with amino acids RSCLIHTSEKKAEIPPKTYSLQIAWVGGFIAISIISFLSLLGVILVPLMN

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC39A6 Blocking Peptide, catalog no. 33R-8173, is also available for use as a blocking control in assays to test for specificity of this SLC39A6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC39A6

Target: SLC39A6 (Solute Carrier Family 39 (Zinc Transporter), Member 6 (SLC39A6))

Andere Bezeichnung: SLC39A6 (SLC39A6 Produkte)

Synonyme: liv1 antikoerper, wu:fc25a09 antikoerper, ZIP6 antikoerper, Ermelin antikoerper, LIV-1 antikoerper, solute carrier family 39 (zinc transporter), member 6 antikoerper, solute carrier family 39 member 6 antikoerper, solute carrier family 39 (metal ion transporter), member 6 antikoerper, slc39a6 antikoerper, SLC39A6 antikoerper, Slc39a6 antikoerper

Hintergrund: Zinc is an essential cofactor for hundreds of enzymes. It is involved in protein, nucleic acid, carbohydrate, and lipid metabolism, as well as in the control of gene transcription, growth, development, and differentiation. SLC39A6 belongs to a subfamily of proteins that show structural characteristics of zinc transporters.

Molekulargewicht: 48 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis