NOV Antikörper (C-Term)

Produktnummer ABIN630288

Dieses Anti-NOV-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von NOV in WB. Geeignet für Human.

Kurzübersicht für NOV Antikörper (C-Term) (ABIN630288)

Target: NOV (Nephroblastoma Overexpressed (NOV))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NOV Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-NOV Antikörper

Bindungsspezifität: C-Term

Spezifität: NOV antibody was raised against the C terminal of NOV

Aufreinigung: Purified

Immunogen: NOV antibody was raised using the C terminal of NOV corresponding to a region with amino acids KTIQAEFQCSPGQIVKKPVMVIGTCTCHTNCPKNNEAFLQELELKTTRGK

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NOV Blocking Peptide, (ABIN940066), is also available for use as a blocking control in assays to test for specificity of this NOV antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NOV antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NOV

Target: NOV (Nephroblastoma Overexpressed (NOV))

Andere Bezeichnung: NOV

Hintergrund: As an immediate-early protein, NOV is likely to play a role in cell growth regulation.

Molekulargewicht: 39 kDa (MW of target protein)

Pathways: Smooth Muscle Cell Migration, Growth Factor Binding