Osteopontin Antikörper

Produktnummer ABIN630280

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch Osteopontin in WB und IHC. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für Osteopontin Antikörper (ABIN630280)

Target: Osteopontin (SPP1) (Secreted phosphoprotein 1 (SPP1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Osteopontin Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-Osteopontin Antikörper

Aufreinigung: Purified

Immunogen: SPP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids DSQELSKVSREFHSHEFHSHEDMLVVDPKSKEEDKHLKFRISHELDSASS

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SPP1 Blocking Peptide, (ABIN937560), is also available for use as a blocking control in assays to test for specificity of this SPP1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SPP1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Osteopontin

Target: Osteopontin (SPP1) (Secreted phosphoprotein 1 (SPP1))

Andere Bezeichnung: SPP1

Hintergrund: The SPP1 gene encodes an acidic matrix protein, mainly expressed in mineralized tissues, kidney and atherosclerotic vessels. This protein also contributes to several steps in the process of prostate carcinogenesis and metastasis.

Molekulargewicht: 33 kDa (MW of target protein)

Pathways: Regulation of Cell Size