Annexin a1 Antikörper (N-Term)
-
- Target Alle Annexin a1 (ANXA1) Antikörper anzeigen
- Annexin a1 (ANXA1) (Annexin A1 (ANXA1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Chemical
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Annexin a1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- Annexin A1 antibody was raised against the N terminal of ANXA1
- Kreuzreaktivität
- Human
- Aufreinigung
- Purified
- Immunogen
- Annexin A1 antibody was raised using the N terminal of ANXA1 corresponding to a region with amino acids WFIENEEQEYVQTVKSSKGGPGSAVSPYPTFNPSSDVAALHKAIMVKGVD
- Top Product
- Discover our top product ANXA1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Annexin A1 Blocking Peptide, catalog no. 33R-9944, is also available for use as a blocking control in assays to test for specificity of this Annexin A1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANXA1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Annexin a1 (ANXA1) (Annexin A1 (ANXA1))
- Andere Bezeichnung
- Annexin A1 (ANXA1 Produkte)
- Synonyme
- anx1a antikoerper, anxa1 antikoerper, wu:fa01d11 antikoerper, wu:fa05d11 antikoerper, wu:fk69h01 antikoerper, MGC64363 antikoerper, anx1 antikoerper, lpc1 antikoerper, MGC89164 antikoerper, ANXA1 antikoerper, ANX1 antikoerper, LPC1 antikoerper, p35 antikoerper, Anx-1 antikoerper, Anx-A1 antikoerper, C430014K04Rik antikoerper, Lpc-1 antikoerper, Lpc1 antikoerper, Anx1 antikoerper, annexin A1a antikoerper, annexin A1 antikoerper, annexin A1 L homeolog antikoerper, Annexin A1 antikoerper, anxa1a antikoerper, anxa1 antikoerper, anxa1.L antikoerper, ANXA1 antikoerper, LOC100335033 antikoerper, Anxa1 antikoerper
- Substanzklasse
- Chemical
- Hintergrund
- ANXA1 encodes a protein that belongs to a family of Ca(2+)-dependent phospholipid binding proteins which have a molecular weight of approximately 35,000 to 40,000 and are preferentially located on the cytosolic face of the plasma membrane. Annexin I protein has an apparent relative molecular mass of 40 kDa, with phospholipase A2 inhibitory activity. Since phospholipase A2 is required for the biosynthesis of the potent mediators of inflammation, prostaglandins and leukotrienes, annexin I may have potential anti-inflammatory activity.
- Molekulargewicht
- 38 kDa (MW of target protein)
- Pathways
- Hormone Transport
-