GJC1 Antikörper (N-Term)

Produktnummer ABIN630269

Produktdetails anti-GJC1 Antikörper

Target: GJC1 (Gap Junction Protein, gamma 1, 45kDa (GJC1))

Bindungsspezifität: N-Term

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GJC1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: GJC1 antibody was raised against the N terminal of GJC1

Aufreinigung: Purified

Immunogen: GJC1 antibody was raised using the N terminal of GJC1 corresponding to a region with amino acids IFRILVLATVGGAVFEDEQEEFVCNTLQPGCRQTCYDRAFPVSHYRFWLF

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GJC1 Blocking Peptide, catalog no. 33R-3961, is also available for use as a blocking control in assays to test for specificity of this GJC1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GJC1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GJC1

Target: GJC1 (Gap Junction Protein, gamma 1, 45kDa (GJC1))

Andere Bezeichnung: GJC1 (GJC1 Produkte)

Synonyme: CX45 antikoerper, GJA7 antikoerper, cx45 antikoerper, gja7 antikoerper, MGC52735 antikoerper, GJD3 antikoerper, GJC1 antikoerper, C130009G16Rik antikoerper, Cnx45 antikoerper, Cx45 antikoerper, Gja-7 antikoerper, Gja7 antikoerper, gap junction protein gamma 1 antikoerper, gap junction protein gamma 1 L homeolog antikoerper, gap junction protein, delta 3, 31.9kDa antikoerper, gap junction protein, gamma 1 antikoerper, Gap junction gamma-1 protein antikoerper, GJC1 antikoerper, gjc1.L antikoerper, GJD3 antikoerper, Gjc1 antikoerper, gjc1 antikoerper

Hintergrund: CX31.9 is a member of the large family of connexins that are required for the formation of gap junctions. Six connexin monomers form a hemichannel, or connexon, on the cell surface. This connexon can interact with a connexon from a neighboring cell, thus forming a channel linking the cytoplasm of the 2 cells.

Molekulargewicht: 32 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization