Claudin 17 Antikörper (Middle Region)

Produktnummer ABIN630266

Produktdetails anti-Claudin 17 Antikörper

Target: Claudin 17 (CLDN17)

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Claudin 17 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: Claudin 17 antibody was raised against the middle region of CLDN17

Aufreinigung: Purified

Immunogen: Claudin 17 antibody was raised using the middle region of CLDN17 corresponding to a region with amino acids KQVQCTGSNERAKAYLLGTSGVLFILTGIFVLIPVSWTANIIIRDFYNPA

Anwendungsinformationen

Applikationshinweise: WB: 2 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Claudin 17 Blocking Peptide, catalog no. 33R-4616, is also available for use as a blocking control in assays to test for specificity of this Claudin 17 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLDN17 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Claudin 17

Target: Claudin 17 (CLDN17)

Andere Bezeichnung: Claudin 17 (CLDN17 Produkte)

Synonyme: CLDN17 antikoerper, Claudin-17 antikoerper, zgc:173444 antikoerper, claudin 17 antikoerper, CLDN17 antikoerper, cldn17 antikoerper, Cldn17 antikoerper

Hintergrund: CLDN17, clustered with CLDN8 at human chromosome 21q22.11, is a four-transmembrane protein with WWCC motif, defined by W-X(17-22)-W-X(2)-C-X(8-10)-C.

Molekulargewicht: 25 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization, Hepatitis C