Claudin 17 Antikörper (Middle Region)

Produktnummer ABIN630266

Der Kaninchen Polyklonal Anti-Claudin 17-Antikörper wurde für WB und IHC validiert. Er ist geeignet, Claudin 17 in Proben von Human, Maus, Ratte und Hund zu detektieren.

Kurzübersicht für Claudin 17 Antikörper (Middle Region) (ABIN630266)

Target: Claudin 17 (CLDN17)

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Claudin 17 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-Claudin 17 Antikörper

Bindungsspezifität: Middle Region

Spezifität: Claudin 17 antibody was raised against the middle region of CLDN17

Aufreinigung: Purified

Immunogen: Claudin 17 antibody was raised using the middle region of CLDN17 corresponding to a region with amino acids KQVQCTGSNERAKAYLLGTSGVLFILTGIFVLIPVSWTANIIIRDFYNPA

Anwendungsinformationen

Applikationshinweise: WB: 2 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Claudin 17 Blocking Peptide, (ABIN940002), is also available for use as a blocking control in assays to test for specificity of this Claudin 17 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLDN17 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Claudin 17

Target: Claudin 17 (CLDN17)

Andere Bezeichnung: Claudin 17

Hintergrund: CLDN17, clustered with CLDN8 at human chromosome 21q22.11, is a four-transmembrane protein with WWCC motif, defined by W-X(17-22)-W-X(2)-C-X(8-10)-C.

Molekulargewicht: 25 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization, Hepatitis C