Claudin 15 Antikörper (C-Term)

Produktnummer ABIN630261

Produktdetails anti-Claudin 15 Antikörper

Target: Claudin 15 (CLDN15)

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Claudin 15 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Claudin 15 antibody was raised against the C terminal of CLDN15

Aufreinigung: Purified

Immunogen: Claudin 15 antibody was raised using the C terminal of CLDN15 corresponding to a region with amino acids LCSACCCGSDEDPAASARRPYQAPVSVMPVATSDQEGDSSFGKYGRNAYV

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Claudin 15 Blocking Peptide, catalog no. 33R-4831, is also available for use as a blocking control in assays to test for specificity of this Claudin 15 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLDN15 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Claudin 15

Target: Claudin 15 (CLDN15)

Andere Bezeichnung: Claudin 15 (CLDN15 Produkte)

Synonyme: CLDN15 antikoerper, cldn15 antikoerper, cldn15l antikoerper, zgc:63943 antikoerper, zgc:136755 antikoerper, 2210009B08Rik antikoerper, BB107105 antikoerper, claudin 15 antikoerper, claudin 15a antikoerper, claudin 15b antikoerper, Cldn15 antikoerper, CLDN15 antikoerper, cldn15a antikoerper, cldn15b antikoerper

Hintergrund: Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. These junctions are comprised of sets of continuous networking strands in the outwardly facing cytoplasmic leaflet, with complementary grooves in the inwardly facing extracytoplasmic leaflet.

Molekulargewicht: 24 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization, Hepatitis C