GJB2 Antikörper (N-Term)
-
- Target Alle GJB2 Antikörper anzeigen
- GJB2 (Gap Junction Protein, beta 2, 26kDa (GJB2))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser GJB2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- GJB2 antibody was raised against the N terminal of GJB2
- Aufreinigung
- Purified
- Immunogen
- GJB2 antibody was raised using the N terminal of GJB2 corresponding to a region with amino acids STPALLVAMHVAYRRHEKKRKFIKGEIKSEFKDIEEIKTQKVRIEGSLWW
- Top Product
- Discover our top product GJB2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
GJB2 Blocking Peptide, catalog no. 33R-8880, is also available for use as a blocking control in assays to test for specificity of this GJB2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GJB2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GJB2 (Gap Junction Protein, beta 2, 26kDa (GJB2))
- Andere Bezeichnung
- GJB2 (GJB2 Produkte)
- Synonyme
- ppk antikoerper, cx26 antikoerper, dfna3 antikoerper, dfnb1 antikoerper, nsrd1 antikoerper, dfna3a antikoerper, dfnb1a antikoerper, MGC53062 antikoerper, connexin-26 antikoerper, GJB2 antikoerper, AI325222 antikoerper, Cnx26 antikoerper, Cx26 antikoerper, Gjb-2 antikoerper, CXN-26 antikoerper, CX26 antikoerper, DFNA3 antikoerper, DFNA3A antikoerper, DFNB1 antikoerper, DFNB1A antikoerper, HID antikoerper, KID antikoerper, NSRD1 antikoerper, PPK antikoerper, gap junction protein beta 2 L homeolog antikoerper, gap junction protein beta 2 antikoerper, gap junction protein, beta 2 antikoerper, gjb2.L antikoerper, GJB2 antikoerper, Gjb2 antikoerper
- Hintergrund
- Gap junctions were first characterized by electron microscopy as regionally specialized structures on plasma membranes of contacting adherent cells. These structures were shown to consist of cell-to-cell channels. Proteins, called connexins, purified from fractions of enriched gap junctions from different tissues differ. The connexins are designated by their molecular mass. Another system of nomenclature divides gap junction proteins into 2 categories, alpha and beta, according to sequence similarities at the nucleotide and amino acid levels. For example, CX43 is designated alpha-1 gap junction protein, whereas CX32 and CX26 are called beta-1 and beta-2 gap junction proteins, respectively. This nomenclature emphasizes that CX32 and CX26 are more homologous to each other than either of them is to CX43.
- Molekulargewicht
- 25 kDa (MW of target protein)
- Pathways
- Sensory Perception of Sound, Cell-Cell Junction Organization
-