Annexin IV Antikörper (N-Term)

Produktnummer ABIN630249

Produktdetails anti-Annexin IV Antikörper

Target: Annexin IV (ANXA4) (Annexin A4 (ANXA4))

Bindungsspezifität: N-Term

Reaktivität: Chemical

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Annexin IV Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: Annexin A4 antibody was raised against the N terminal of ANXA4

Kreuzreaktivität: Human, Ratte (Rattus), Hund

Aufreinigung: Purified

Immunogen: Annexin A4 antibody was raised using the N terminal of ANXA4 corresponding to a region with amino acids GLGTDEDAIISVLAYRNTAQRQEIRTAYKSTIGRDLIDDLKSELSGNFEQ

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Annexin A4 Blocking Peptide, catalog no. 33R-3396, is also available for use as a blocking control in assays to test for specificity of this Annexin A4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANXA4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Annexin IV

Target: Annexin IV (ANXA4) (Annexin A4 (ANXA4))

Andere Bezeichnung: Annexin A4 (ANXA4 Produkte)

Synonyme: ANXA4 antikoerper, Anx4 antikoerper, XAnx4 antikoerper, pig28 antikoerper, X-anx4 antikoerper, Xanx-4 antikoerper, ANXIV antikoerper, anx4 antikoerper, ANX4 antikoerper, PIG28 antikoerper, ZAP36 antikoerper, Annexin-4 antikoerper, P32.5 antikoerper, PAP-II antikoerper, PP4-X antikoerper, AI265406 antikoerper, AIV antikoerper, AW106930 antikoerper, annexin A4 antikoerper, annexin A4 L homeolog antikoerper, ANXA4 antikoerper, anxa4 antikoerper, CC1G_00713 antikoerper, LOC100280951 antikoerper, Anxa4 antikoerper, anxa4.L antikoerper

Substanzklasse: Chemical

Hintergrund: Annexin A4 (ANXA4) belongs to the annexin family of calcium-dependent phospholipid binding proteins. Although their functions are still not clearly defined, several members of the annexin family have been implicated in membrane-related events along exocytotic and endocytotic pathways. ANXA4 has 45 to 59 % identity with other members of its family and shares a similar size and exon-intron organization. Isolated from human placenta, ANXA4 encodes a protein that has possible interactions with ATP, and has in vitro anticoagulant activity and also inhibits phospholipase A2 activity. ANXA4 is almost exclusively expressed in epithelial cells.

Molekulargewicht: 35 kDa (MW of target protein)