Annexin A13 Antikörper (N-Term)

Produktnummer ABIN630247

Produktdetails anti-Annexin A13 Antikörper

Target: Annexin A13 (ANXA13)

Bindungsspezifität: N-Term

Reaktivität: Chemical

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Annexin A13 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Annexin A13 antibody was raised against the N terminal of ANXA13

Kreuzreaktivität: Human, Hund

Aufreinigung: Purified

Immunogen: Annexin A13 antibody was raised using the N terminal of ANXA13 corresponding to a region with amino acids KKLNKACKGMGTNEAAIIEILSGRTSDERQQIKQKYKATYGKELEEVLKS

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Annexin A13 Blocking Peptide, catalog no. 33R-4483, is also available for use as a blocking control in assays to test for specificity of this Annexin A13 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANXA13 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Annexin A13

Target: Annexin A13 (ANXA13)

Andere Bezeichnung: Annexin A13 (ANXA13 Produkte)

Synonyme: ANX13 antikoerper, ISA antikoerper, anxa6 antikoerper, MGC82170 antikoerper, 1810034H17Rik antikoerper, AV055219 antikoerper, anx13 antikoerper, wu:fb40a08 antikoerper, ANXA13 antikoerper, MGC108373 antikoerper, annexin A13 antikoerper, annexin A13 L homeolog antikoerper, ANXA13 antikoerper, anxa13.L antikoerper, Anxa13 antikoerper, anxa13 antikoerper, PAAG_01138 antikoerper

Substanzklasse: Chemical

Hintergrund: The ANXA13 gene encodes a member of the annexin family. Members of this calcium-dependent phospholipid-binding protein family play a role in the regulation of cellular growth and in signal transduction pathways. The specific function of ANXA13 has not yet been determined, however, it is associated with the plasma membrane of undifferentiated, proliferating endothelial cells and differentiated villus enterocytes.

Molekulargewicht: 39 kDa (MW of target protein)