ANXA6 Antikörper (N-Term)

Produktnummer ABIN630246

Dieses Anti-ANXA6-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von ANXA6 in WB. Geeignet für Chemical.

Kurzübersicht für ANXA6 Antikörper (N-Term) (ABIN630246)

Target: ANXA6 (Annexin A6 (ANXA6))

Reaktivität: Chemical

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ANXA6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ANXA6 Antikörper

Bindungsspezifität: N-Term

Spezifität: Annexin A6 antibody was raised against the N terminal of ANXA6

Kreuzreaktivität: Human

Aufreinigung: Purified

Immunogen: Annexin A6 antibody was raised using the N terminal of ANXA6 corresponding to a region with amino acids ALYTAMKGFGSDKEAILDIITSRSNRQRQEVCQSYKSLYGKDLIADLKYE

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Annexin A6 Blocking Peptide, catalog no. 33R-1381, is also available for use as a blocking control in assays to test for specificity of this Annexin A6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANXA6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ANXA6

Target: ANXA6 (Annexin A6 (ANXA6))

Andere Bezeichnung: Annexin A6

Substanzklasse: Chemical

Hintergrund: Annexin VI belongs to a family of calcium-dependent membrane and phospholipid binding proteins. Although their functions are still not clearly defined, several members of the annexin family have been implicated in membrane-related events along exocytotic and endocytotic pathways. The annexin VI gene is approximately 60 kbp long and contains 26 exons. It encodes a protein of about 68 kDa that consists of eight 68-amino acid repeats separated by linking sequences of variable lengths. It is highly similar to human annexins I and II sequences, each of which contain four such repeats. Exon 21 of annexin VI is alternatively spliced, giving rise to two isoforms that differ by a 6-amino acid insertion at the start of the seventh repeat. Annexin VI has been implicated in mediating the endosome aggregation and vesicle fusion in secreting epithelia during exocytosis.

Molekulargewicht: 74 kDa (MW of target protein)