ANXA6 Antikörper (N-Term)
-
- Target Alle ANXA6 Antikörper anzeigen
- ANXA6 (Annexin A6 (ANXA6))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Chemical
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ANXA6 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Annexin A6 antibody was raised against the N terminal of ANXA6
- Kreuzreaktivität
- Human
- Aufreinigung
- Purified
- Immunogen
- Annexin A6 antibody was raised using the N terminal of ANXA6 corresponding to a region with amino acids ALYTAMKGFGSDKEAILDIITSRSNRQRQEVCQSYKSLYGKDLIADLKYE
- Top Product
- Discover our top product ANXA6 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Annexin A6 Blocking Peptide, catalog no. 33R-1381, is also available for use as a blocking control in assays to test for specificity of this Annexin A6 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANXA6 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ANXA6 (Annexin A6 (ANXA6))
- Andere Bezeichnung
- Annexin A6 (ANXA6 Produkte)
- Substanzklasse
- Chemical
- Hintergrund
- Annexin VI belongs to a family of calcium-dependent membrane and phospholipid binding proteins. Although their functions are still not clearly defined, several members of the annexin family have been implicated in membrane-related events along exocytotic and endocytotic pathways. The annexin VI gene is approximately 60 kbp long and contains 26 exons. It encodes a protein of about 68 kDa that consists of eight 68-amino acid repeats separated by linking sequences of variable lengths. It is highly similar to human annexins I and II sequences, each of which contain four such repeats. Exon 21 of annexin VI is alternatively spliced, giving rise to two isoforms that differ by a 6-amino acid insertion at the start of the seventh repeat. Annexin VI has been implicated in mediating the endosome aggregation and vesicle fusion in secreting epithelia during exocytosis.
- Molekulargewicht
- 74 kDa (MW of target protein)
-