Annexin VII Antikörper (N-Term)

Produktnummer ABIN630240

Produktdetails anti-Annexin VII Antikörper

Target: Annexin VII (ANXA7) (Annexin A7 (ANXA7))

Bindungsspezifität: N-Term

Reaktivität: Chemical

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Annexin VII Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Annexin A7 antibody was raised against the N terminal of ANXA7

Kreuzreaktivität: Human

Aufreinigung: Purified

Immunogen: Annexin A7 antibody was raised using the N terminal of ANXA7 corresponding to a region with amino acids MSYPGYPPTGYPPFPGYPPAGQESSFPPSGQYPYPSGFPPMGGGAYPQVP

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Annexin A7 Blocking Peptide, catalog no. 33R-6528, is also available for use as a blocking control in assays to test for specificity of this Annexin A7 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANXA7 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Annexin VII

Target: Annexin VII (ANXA7) (Annexin A7 (ANXA7))

Andere Bezeichnung: Annexin A7 (ANXA7 Produkte)

Synonyme: ANX7 antikoerper, SNX antikoerper, SYNEXIN antikoerper, AI265384 antikoerper, AI316497 antikoerper, Anx7 antikoerper, synexin antikoerper, anxa7 antikoerper, MGC76267 antikoerper, MGC82023 antikoerper, ANXA7 antikoerper, MGC83033 antikoerper, annexin A7 antikoerper, annexin VII antikoerper, annexin A7 S homeolog antikoerper, ANXA7 antikoerper, Anxa7 antikoerper, anxa7 antikoerper, anxa7.S antikoerper, PTRG_02166 antikoerper, BRAFLDRAFT_231082 antikoerper, PAAG_00136 antikoerper, MCYG_04180 antikoerper, VDBG_06328 antikoerper, MGYG_02426 antikoerper

Substanzklasse: Chemical

Hintergrund: ANXA7 is a member of the annexin family of calcium-dependent phospholipid binding proteins. The Annexin VII gene contains 14 exons and spans approximately 34 kb of DNA. An alternatively spliced cassette exon results in two mRNA transcripts of 2.0 and 2.4 kb which are predicted to generate two protein isoforms differing in their N-terminal domain. The alternative splicing event is tissue specific and the mRNA containing the cassette exon is prevalent in brain, heart and skeletal muscle.

Molekulargewicht: 51 kDa (MW of target protein)