Annexin VII Antikörper (N-Term)

Produktnummer ABIN630240

Dieses Anti-Annexin VII-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von Annexin VII in WB. Geeignet für Chemical.

Kurzübersicht für Annexin VII Antikörper (N-Term) (ABIN630240)

Target: Annexin VII (ANXA7) (Annexin A7 (ANXA7))

Reaktivität: Chemical

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Annexin VII Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Annexin VII Antikörper

Bindungsspezifität: N-Term

Spezifität: Annexin A7 antibody was raised against the N terminal of ANXA7

Kreuzreaktivität: Human

Aufreinigung: Purified

Immunogen: Annexin A7 antibody was raised using the N terminal of ANXA7 corresponding to a region with amino acids MSYPGYPPTGYPPFPGYPPAGQESSFPPSGQYPYPSGFPPMGGGAYPQVP

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Annexin A7 Blocking Peptide, (ABIN5612083), is also available for use as a blocking control in assays to test for specificity of this Annexin A7 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANXA7 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Annexin VII

Target: Annexin VII (ANXA7) (Annexin A7 (ANXA7))

Andere Bezeichnung: Annexin A7

Substanzklasse: Chemical

Hintergrund: ANXA7 is a member of the annexin family of calcium-dependent phospholipid binding proteins. The Annexin VII gene contains 14 exons and spans approximately 34 kb of DNA. An alternatively spliced cassette exon results in two mRNA transcripts of 2.0 and 2.4 kb which are predicted to generate two protein isoforms differing in their N-terminal domain. The alternative splicing event is tissue specific and the mRNA containing the cassette exon is prevalent in brain, heart and skeletal muscle.

Molekulargewicht: 51 kDa (MW of target protein)