MGST2 Antikörper (N-Term)

Produktnummer ABIN630237

Dieses Anti-MGST2-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von MGST2 in WB und IHC. Geeignet für Human.

Kurzübersicht für MGST2 Antikörper (N-Term) (ABIN630237)

Target: MGST2 (Microsomal Glutathione S-Transferase 2 (MGST2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MGST2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-MGST2 Antikörper

Bindungsspezifität: N-Term

Spezifität: MGST2 antibody was raised against the N terminal of MGST2

Aufreinigung: Purified

Immunogen: MGST2 antibody was raised using the N terminal of MGST2 corresponding to a region with amino acids MAGNSILLAAVSILSACQQSYFALQVGKARLKYKVTPPAVTGSPEFERVF

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MGST2 Blocking Peptide, catalog no. 33R-5664, is also available for use as a blocking control in assays to test for specificity of this MGST2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MGST2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MGST2

Target: MGST2 (Microsomal Glutathione S-Transferase 2 (MGST2))

Andere Bezeichnung: MGST2

Hintergrund: The MAPEG (Membrane Associated Proteins in Eicosanoid and Glutathione metabolism) family consists of six human proteins, several of which are involved in the production of leukotrienes and prostaglandin E, important mediators of inflammation. MGST2 is a protein which catalyzes the conjugation of leukotriene A4 and reduced glutathione to produce leukotriene C4.

Molekulargewicht: 16 kDa (MW of target protein)