BDKRB2 Antikörper (N-Term)

Produktnummer ABIN630235

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch BDKRB2 in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für BDKRB2 Antikörper (N-Term) (ABIN630235)

Target: BDKRB2 (Bradykinin Receptor B2 (BDKRB2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser BDKRB2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-BDKRB2 Antikörper

Bindungsspezifität: N-Term

Spezifität: Bradykinin Receptor B2 antibody was raised against the N terminal of BDKRB2

Aufreinigung: Purified

Immunogen: Bradykinin Receptor B2 antibody was raised using the N terminal of BDKRB2 corresponding to a region with amino acids MFSPWKISMFLSVREDSVPTTASFSADMLNVTLQGPTLNGTFAQSKCPQV

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Bradykinin Receptor B2 Blocking Peptide, (ABIN5612357), is also available for use as a blocking control in assays to test for specificity of this Bradykinin Receptor B2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BDKRB2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu BDKRB2

Target: BDKRB2 (Bradykinin Receptor B2 (BDKRB2))

Andere Bezeichnung: Bradykinin Receptor B2

Hintergrund: BDKRB2 is a receptor for bradykinin. The 9 aa bradykinin peptide elicits many responses including vasodilation, edema, smooth muscle spasm and pain fiber stimulation. This receptor associates with G proteins that stimulate a phosphatidylinositol-calcium second messenger system.

Molekulargewicht: 43 kDa (MW of target protein)

Pathways: ACE Inhibitor Pathway, Negative Regulation of intrinsic apoptotic Signaling