KLK-B1 Antikörper

Produktnummer ABIN630229

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für KLK-B1 Antikörper (ABIN630229)

Target: KLK-B1

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Applikation: Western Blotting (WB)

Produktdetails

Aufreinigung: Purified

Immunogen: KLK-B1 antibody was raised using a synthetic peptide corresponding to a region with amino acids VLTAAHCFDGLPLQDVWRIYSGILNLSDITKDTPFSQIKEIIIHQNYKVS

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KLK-B1 Blocking Peptide, (ABIN5614387), is also available for use as a blocking control in assays to test for specificity of this KLK-B1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLKB1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Antigendetails

Target: KLK-B1

Hintergrund: Plasma prekallikrein is a glycoprotein that participates in the surface-dependent activation of blood coagulation, fibrinolysis, kinin generation and inflammation. It is synthesized in the liver and secreted into the blood as a single polypeptide chain. Plasma prekallikrein is converted to plasma kallikrein by factor XIIa by the cleavage of an internal Arg-Ile bond. Plasma prekallikrein deficiency causes a prolonged activated partial thromboplastin time in patients.

Molekulargewicht: 28 kDa (MW of target protein)