GNAS Antikörper (N-Term)

Produktnummer ABIN630225

Produktdetails anti-GNAS Antikörper

Target: GNAS (GNAS Complex Locus (GNAS))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GNAS Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: GNAS antibody was raised against the N terminal of GNAS

Aufreinigung: Purified

Immunogen: GNAS antibody was raised using the N terminal of GNAS corresponding to a region with amino acids SGKSTIVKQMRILHVNGFNGDSEKATKVQDIKNNLKEAIETIVAAMSNLV

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GNAS Blocking Peptide, catalog no. 33R-8471, is also available for use as a blocking control in assays to test for specificity of this GNAS antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GNAS antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GNAS

Target: GNAS (GNAS Complex Locus (GNAS))

Andere Bezeichnung: GNAS (GNAS Produkte)

Synonyme: AHO antikoerper, C20orf45 antikoerper, GNAS1 antikoerper, GPSA antikoerper, GSA antikoerper, GSP antikoerper, NESP antikoerper, PHP1A antikoerper, PHP1B antikoerper, PHP1C antikoerper, POH antikoerper, GNAS antikoerper, PORGSA1 antikoerper, G-alpha-S antikoerper, 5530400H20Rik antikoerper, A930027G11Rik antikoerper, C130027O20Rik antikoerper, Galphas antikoerper, Gnas1 antikoerper, Gnasxl antikoerper, Gsa antikoerper, Nesp antikoerper, Nespl antikoerper, Oed-Sml antikoerper, Oedsml antikoerper, P1 antikoerper, P2 antikoerper, P3 antikoerper, G-alpha-s antikoerper, gnas-a antikoerper, Gnpas antikoerper, Nesp55 antikoerper, gnal antikoerper, Gnas antikoerper, GNAS complex locus antikoerper, guanine nucleotide-binding protein G(s) subunit alpha antikoerper, GNAS (guanine nucleotide binding protein, alpha stimulating) complex locus antikoerper, GNAS complex locus S homeolog antikoerper, neuroendocrine secretory protein 55-like antikoerper, GNAS antikoerper, LOC694289 antikoerper, LOC469986 antikoerper, Gnas antikoerper, gnas.S antikoerper, gnas antikoerper, LOC100346323 antikoerper, LOC100442753 antikoerper, LOC100732436 antikoerper

Hintergrund: Mutations in GNAS gene result in pseudohypoparathyroidism type 1a, pseudohypoparathyroidism type 1b, Albright hereditary osteodystrophy, pseudopseudohypoparathyroidism, McCune-Albright syndrome, progressive osseus heteroplasia, polyostotic fibrous dysplasia of bone, and some pituitary tumors.

Molekulargewicht: 42 kDa (MW of target protein)

Pathways: Thyroid Hormone Synthesis, cAMP Metabolic Process, Myometrial Relaxation and Contraction, Embryonic Body Morphogenesis