NSMCE1 Antikörper

Produktnummer ABIN630218

Der Kaninchen-Polyklonal Anti-NSMCE1-Antikörper wurde für WB validiert. Er ist geeignet zum Nachweis von NSMCE1 in Proben aus Human, Maus und Ratte. }

Kurzübersicht für NSMCE1 Antikörper (ABIN630218)

Target: NSMCE1 (Non-SMC Element 1 Homolog (NSMCE1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NSMCE1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-NSMCE1 Antikörper

Aufreinigung: Purified

Immunogen: NSMCE1 antibody was raised using a synthetic peptide corresponding to a region with amino acids RPIYALVNLATTSISKMATDFAENELDLFRKALELIIDSETGFASSTNIL

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NSMCE1 Blocking Peptide, (ABIN5615067), is also available for use as a blocking control in assays to test for specificity of this NSMCE1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NSMCE1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NSMCE1

Target: NSMCE1 (Non-SMC Element 1 Homolog (NSMCE1))

Andere Bezeichnung: NSMCE1

Hintergrund: NSMCE1 is a probable component of the SMC5-SMC6 complex, a complex involved in DNA double-strand breaks by homologous recombination. The complex may promote sister chromatid homologous recombination by recruiting the SMC1-SMC3 cohesin complex to double-strand breaks.

Molekulargewicht: 28 kDa (MW of target protein)

Pathways: Positive Regulation of Response to DNA Damage Stimulus