NSMCE1 Antikörper
-
- Target Alle NSMCE1 Antikörper anzeigen
- NSMCE1 (Non-SMC Element 1 Homolog (NSMCE1))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser NSMCE1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Purified
- Immunogen
- NSMCE1 antibody was raised using a synthetic peptide corresponding to a region with amino acids RPIYALVNLATTSISKMATDFAENELDLFRKALELIIDSETGFASSTNIL
- Top Product
- Discover our top product NSMCE1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
NSMCE1 Blocking Peptide, catalog no. 33R-8094, is also available for use as a blocking control in assays to test for specificity of this NSMCE1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NSMCE1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NSMCE1 (Non-SMC Element 1 Homolog (NSMCE1))
- Andere Bezeichnung
- NSMCE1 (NSMCE1 Produkte)
- Hintergrund
- NSMCE1 is a probable component of the SMC5-SMC6 complex, a complex involved in DNA double-strand breaks by homologous recombination. The complex may promote sister chromatid homologous recombination by recruiting the SMC1-SMC3 cohesin complex to double-strand breaks.
- Molekulargewicht
- 28 kDa (MW of target protein)
- Pathways
- Positive Regulation of Response to DNA Damage Stimulus
-