PIK3R3 Antikörper

Produktnummer ABIN630213

Produktdetails anti-PIK3R3 Antikörper

Target: PIK3R3 (Phosphatidylinositol 3-kinase regulatory subunit gamma (PIK3R3))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PIK3R3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Purified

Immunogen: PIK3 R3 antibody was raised using a synthetic peptide corresponding to a region with amino acids EYTRTSQEIQMKRTAIEAFNETIKIFEEQCHTQEQHSKEYIERFRREGNE

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PIK3R3 Blocking Peptide, catalog no. 33R-2832, is also available for use as a blocking control in assays to test for specificity of this PIK3R3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIK0 3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PIK3R3

Target: PIK3R3 (Phosphatidylinositol 3-kinase regulatory subunit gamma (PIK3R3))

Andere Bezeichnung: PIK3R3 (PIK3R3 Produkte)

Synonyme: AA414954 antikoerper, p55pik antikoerper, p55 antikoerper, p55-GAMMA antikoerper, pik3r3 antikoerper, zgc:55564 antikoerper, zgc:85710 antikoerper, phosphoinositide-3-kinase regulatory subunit 3 antikoerper, phosphoinositide-3-kinase, regulatory subunit 3 (gamma) antikoerper, phosphoinositide-3-kinase, regulatory subunit 3b (gamma) antikoerper, PIK3R3 antikoerper, Pik3r3 antikoerper, pik3r3b antikoerper

Hintergrund: PIK3R3 binds to activated (phosphorylated) protein-tyrosine kinases through its SH2 domain and regulates their kinase activity. During insulin stimulation, it also binds to IRS-1.

Molekulargewicht: 54 kDa (MW of target protein)