PAGE1 Antikörper
-
- Target Alle PAGE1 Antikörper anzeigen
- PAGE1 (P Antigen Family, Member 1 (Prostate Associated) (PAGE1))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PAGE1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Purified
- Immunogen
- PAGE1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TKRVCLRNEEQMKLPAEGPEPEADSQEQVHPKTGCERGDGPDVQELGLPN
- Top Product
- Discover our top product PAGE1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PAGE1 Blocking Peptide, catalog no. 33R-9148, is also available for use as a blocking control in assays to test for specificity of this PAGE1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PAGE1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PAGE1 (P Antigen Family, Member 1 (Prostate Associated) (PAGE1))
- Andere Bezeichnung
- PAGE1 (PAGE1 Produkte)
- Synonyme
- AL5 antikoerper, CT16.3 antikoerper, GAGE-9 antikoerper, GAGEB1 antikoerper, PAGE-1 antikoerper, PAGE family member 1 antikoerper, PAGE1 antikoerper
- Hintergrund
- PAGE1 belongs to a family that are expressed in a variety of tumors but not in normal tissues, except for the testis. Nothing is presently known about the function of this protein.
- Molekulargewicht
- 16 kDa (MW of target protein)
-