PAGE1 Antikörper

Produktnummer ABIN630210

Dieser Anti-PAGE1 Antikörper ist ein Kaninchen Polyklonal Antikörper zur Detektion von PAGE1 in WB. Geeignet für Human.

Kurzübersicht für PAGE1 Antikörper (ABIN630210)

Target: PAGE1 (P Antigen Family, Member 1 (Prostate Associated) (PAGE1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PAGE1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PAGE1 Antikörper

Aufreinigung: Purified

Immunogen: PAGE1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TKRVCLRNEEQMKLPAEGPEPEADSQEQVHPKTGCERGDGPDVQELGLPN

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PAGE1 Blocking Peptide, (ABIN5615192), is also available for use as a blocking control in assays to test for specificity of this PAGE1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PAGE1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PAGE1

Target: PAGE1 (P Antigen Family, Member 1 (Prostate Associated) (PAGE1))

Andere Bezeichnung: PAGE1

Hintergrund: PAGE1 belongs to a family that are expressed in a variety of tumors but not in normal tissues, except for the testis. Nothing is presently known about the function of this protein.

Molekulargewicht: 16 kDa (MW of target protein)