ALOX15B Antikörper (C-Term)

Produktnummer ABIN630208

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch ALOX15B in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für ALOX15B Antikörper (C-Term) (ABIN630208)

Target: ALOX15B (Arachidonate 15-Lipoxygenase B (ALOX15B))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ALOX15B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ALOX15B Antikörper

Bindungsspezifität: C-Term

Spezifität: ALOX15 B antibody was raised against the C terminal of ALOX15

Aufreinigung: Purified

Immunogen: ALOX15 B antibody was raised using the C terminal of ALOX15 corresponding to a region with amino acids ATCEGFIATLPPVNATCDVILALWLLSKEPGDQRPLGTYPDEHFTEEAPR

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ALOX15B Blocking Peptide, (ABIN936938), is also available for use as a blocking control in assays to test for specificity of this ALOX15B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALOX10 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ALOX15B

Target: ALOX15B (Arachidonate 15-Lipoxygenase B (ALOX15B))

Andere Bezeichnung: ALOX15B

Hintergrund: ALOX15B is a member of the lipoxygenase family of structurally related nonheme iron dioxygenases involved in the production of fatty acid hydroperoxides. The protein converts arachidonic acid exclusively to 15S-hydroperoxyeicosatetraenoic acid, while metabolizing linoleic acid less effectively.

Molekulargewicht: 74 kDa (MW of target protein)