HDAC9 Antikörper (C-Term)

Produktnummer ABIN630205

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch HDAC9 in WB und IHC. Er zeigt eine Reaktivität gegenüber Human, Maus und Hund.

Kurzübersicht für HDAC9 Antikörper (C-Term) (ABIN630205)

Target: HDAC9 (Histone Deacetylase 9 (HDAC9))

Reaktivität: Human, Maus, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HDAC9 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-HDAC9 Antikörper

Bindungsspezifität: C-Term

Spezifität: HDAC9 antibody was raised against the C terminal of HDAC9

Aufreinigung: Purified

Immunogen: HDAC9 antibody was raised using the C terminal of HDAC9 corresponding to a region with amino acids QVGAVKVKEEPVDSDEDAQIQEMESGEQAAFMQQVIGKDLAPGFVIKVII

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HDAC9 Blocking Peptide, (ABIN5613973), is also available for use as a blocking control in assays to test for specificity of this HDAC9 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HDAC9 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HDAC9

Target: HDAC9 (Histone Deacetylase 9 (HDAC9))

Andere Bezeichnung: HDAC9

Hintergrund: Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. HDAC9 has sequence homology to members of the histone deacetylase family. The MITR protein lacks the histone deacetylase catalytic domain. It represses MEF2 activity through recruitment of multicomponent corepressor complexes that include CtBP and HDACs. HDAC9 may play a role in hematopoiesis.

Molekulargewicht: 65 kDa (MW of target protein)

Pathways: Regulation of Muscle Cell Differentiation, Skeletal Muscle Fiber Development