HDAC9 Antikörper (C-Term)
-
- Target Alle HDAC9 Antikörper anzeigen
- HDAC9 (Histone Deacetylase 9 (HDAC9))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Maus, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser HDAC9 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- HDAC9 antibody was raised against the C terminal of HDAC9
- Aufreinigung
- Purified
- Immunogen
- HDAC9 antibody was raised using the C terminal of HDAC9 corresponding to a region with amino acids QVGAVKVKEEPVDSDEDAQIQEMESGEQAAFMQQVIGKDLAPGFVIKVII
- Top Product
- Discover our top product HDAC9 Primärantikörper
-
anti-Histone Deacetylase 9 (HDAC9) (AA 2-32), (N-Term) antibody
HDAC9 Reaktivität: Human WB, IF, IP, IHC (p) Wirt: Kaninchen Polyclonal RB2582 unconjugated
anti-Histone Deacetylase 9 (HDAC9) (C-Term) antibodyHDAC9 Reaktivität: Human, Maus, Meerschweinchen, Schaf WB, IHC, ChIP Wirt: Kaninchen Polyclonal unconjugated
anti-Histone Deacetylase 9 (HDAC9) (AA 2-32) antibodyHDAC9 Reaktivität: Human WB, IHC, ELISA, IF, IP Wirt: Kaninchen Polyclonal unconjugated
anti-Histone Deacetylase 9 (HDAC9) antibodyHDAC9 Reaktivität: Human WB, IHC, ELISA, IF Wirt: Kaninchen Monoclonal 1F2 unconjugated Recombinant Antibody
anti-Histone Deacetylase 9 (HDAC9) (AA 343-569) antibodyHDAC9 Reaktivität: Human ELISA, FACS Wirt: Maus Monoclonal 2B7C4 unconjugated
anti-Histone Deacetylase 9 (HDAC9) (AA 23-343) antibodyHDAC9 Reaktivität: Human WB, IHC, IP, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Histone Deacetylase 9 (HDAC9) (AA 503-533), (C-Term) antibodyHDAC9 Reaktivität: Human WB, IHC (p) Wirt: Kaninchen Polyclonal RB2742 unconjugated
anti-Histone Deacetylase 9 (HDAC9) (pSer220), (pSer259) antibodyHDAC9 Reaktivität: Human WB, IHC, ELISA Wirt: Kaninchen Polyclonal unconjugated
anti-Histone Deacetylase 9 (HDAC9) (C-Term) antibodyHDAC9 Reaktivität: Human WB, IHC, ELISA, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Histone Deacetylase 9 (HDAC9) (C-Term) antibodyHDAC9 Reaktivität: Human, Ratte, Maus WB, IHC, ELISA Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
HDAC9 Blocking Peptide, catalog no. 33R-7773, is also available for use as a blocking control in assays to test for specificity of this HDAC9 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HDAC9 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- HDAC9 (Histone Deacetylase 9 (HDAC9))
- Andere Bezeichnung
- HDAC9 (HDAC9 Produkte)
- Hintergrund
- Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. HDAC9 has sequence homology to members of the histone deacetylase family. The MITR protein lacks the histone deacetylase catalytic domain. It represses MEF2 activity through recruitment of multicomponent corepressor complexes that include CtBP and HDACs. HDAC9 may play a role in hematopoiesis.
- Molekulargewicht
- 65 kDa (MW of target protein)
- Pathways
- Regulation of Muscle Cell Differentiation, Skeletal Muscle Fiber Development
-
