TPTE Antikörper (C-Term)

Produktnummer ABIN630201

Dieses Anti-TPTE-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von TPTE in WB und IHC. Geeignet für Human.

Kurzübersicht für TPTE Antikörper (C-Term) (ABIN630201)

Target: TPTE (Transmembrane Phosphatase with Tensin Homology (TPTE))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TPTE Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-TPTE Antikörper

Bindungsspezifität: C-Term

Spezifität: TPTE antibody was raised against the C terminal of TPTE

Aufreinigung: Purified

Immunogen: TPTE antibody was raised using the C terminal of TPTE corresponding to a region with amino acids KILIDVFDGPPLYDDVKVQFFYSNLPTYYDNCSFYFWLHTSFIENNRLYL

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TPTE Blocking Peptide, (ABIN939824), is also available for use as a blocking control in assays to test for specificity of this TPTE antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TPTE antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TPTE

Target: TPTE (Transmembrane Phosphatase with Tensin Homology (TPTE))

Andere Bezeichnung: TPTE

Hintergrund: TPTE encodes a putative transmembrane tyrosine phosphatase that may be involved in signal transduction pathways of the endocrine or spermatogenetic function of the testis.

Molekulargewicht: 45 kDa (MW of target protein)

Pathways: Inositol Metabolic Process