RBMS1 Antikörper (C-Term)

Produktnummer ABIN630197

Der Kaninchen Polyklonal Anti-RBMS1-Antikörper wurde für WB und IHC validiert. Er ist geeignet, RBMS1 in Proben von Human, Maus und Hund zu detektieren.

Kurzübersicht für RBMS1 Antikörper (C-Term) (ABIN630197)

Target: RBMS1 (RNA Binding Motif, Single Stranded Interacting Protein 1 (RBMS1))

Reaktivität: Human, Maus, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RBMS1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-RBMS1 Antikörper

Bindungsspezifität: C-Term

Spezifität: RBMS1 antibody was raised against the C terminal of RBMS1

Aufreinigung: Purified

Immunogen: RBMS1 antibody was raised using the C terminal of RBMS1 corresponding to a region with amino acids TYMPATSAMQGAYLPQYAHMQTTAVPVEEASGQQQVAVETSNDHSPYTFQ

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RBMS1 Blocking Peptide, catalog no. 33R-9396, is also available for use as a blocking control in assays to test for specificity of this RBMS1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBMS1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RBMS1

Target: RBMS1 (RNA Binding Motif, Single Stranded Interacting Protein 1 (RBMS1))

Andere Bezeichnung: RBMS1

Hintergrund: RBMS1 is a member of a small family of proteins which bind single stranded DNA/RNA. These proteins are characterized by the presence of two sets of ribonucleoprotein consensus sequence (RNP-CS) that contain conserved motifs, RNP1 and RNP2, originally described in RNA binding proteins, and required for DNA binding. These proteins have been implicated in such diverse functions as DNA replication, gene transcription, cell cycle progression and apoptosis.

Molekulargewicht: 44 kDa (MW of target protein)