NOLC1 Antikörper (C-Term)

Produktnummer ABIN630195

Dieses Anti-NOLC1-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von NOLC1 in WB und IHC. Geeignet für Human, Ratte, Maus, Hund, Drosophila melanogaster und Arabidopsis.

Kurzübersicht für NOLC1 Antikörper (C-Term) (ABIN630195)

Target: NOLC1 (Nucleolar and Coiled-Body Phosphoprotein 1 (NOLC1))

Reaktivität: Human, Ratte, Maus, Hund, Drosophila melanogaster, Arabidopsis

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NOLC1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-NOLC1 Antikörper

Bindungsspezifität: C-Term

Spezifität: NOLC1 antibody was raised against the C terminal of NOLC1

Aufreinigung: Purified

Immunogen: NOLC1 antibody was raised using the C terminal of NOLC1 corresponding to a region with amino acids DNSFDAKRGAAGDWGERANQVLKFTKGKSFRHEKTKKKRGSYRGGSISVQ

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NOLC1 Blocking Peptide, (ABIN937475), is also available for use as a blocking control in assays to test for specificity of this NOLC1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NOLC1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NOLC1

Target: NOLC1 (Nucleolar and Coiled-Body Phosphoprotein 1 (NOLC1))

Andere Bezeichnung: NOLC1

Hintergrund: Related to nucleologenesis, NOLC1 may play a role in the maintenance of the fundamental structure of the fibrillar center and dense fibrillar component in the nucleolus. It has intrinsic GTPase and ATPase activities. NOLC1 may play an important role in transcription catalyzed by RNA polymerase I.

Molekulargewicht: 73 kDa (MW of target protein)

Pathways: Regulation of G-Protein Coupled Receptor Protein Signaling