IRF6 Antikörper (C-Term)

Produktnummer ABIN630193

Produktdetails anti-IRF6 Antikörper

Target: IRF6 (Interferon Regulatory Factor 6 (IRF6))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte, Hund, Zebrafisch (Danio rerio)

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser IRF6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: IRF6 antibody was raised against the C terminal of IRF6

Aufreinigung: Purified

Immunogen: IRF6 antibody was raised using the C terminal of IRF6 corresponding to a region with amino acids FLSDLIAHQKGQIEKQPPFEIYLCFGEEWPDGKPLERKLILVQVIPVVAR

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

IRF6 Blocking Peptide, catalog no. 33R-2986, is also available for use as a blocking control in assays to test for specificity of this IRF6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IRF6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu IRF6

Target: IRF6 (Interferon Regulatory Factor 6 (IRF6))

Andere Bezeichnung: IRF6 (IRF6 Produkte)

Synonyme: IRF6 antikoerper, lps antikoerper, pit antikoerper, pps antikoerper, vws antikoerper, ofc6 antikoerper, xIRF-6 antikoerper, DKFZp469E012 antikoerper, LPS antikoerper, OFC6 antikoerper, PIT antikoerper, PPS antikoerper, PPS1 antikoerper, VWS antikoerper, VWS1 antikoerper, zgc:63500 antikoerper, AI876454 antikoerper, E230028I05Rik antikoerper, mirf6 antikoerper, interferon regulatory factor 6 antikoerper, interferon regulatory factor 6 S homeolog antikoerper, IRF6 antikoerper, irf6 antikoerper, irf6.S antikoerper, Irf6 antikoerper

Hintergrund: IRF6 is a member of the interferon regulatory transcription factor (IRF) family. Family members share a highly-conserved N-terminal helix-turn-helix DNA-binding domain and a less conserved C-terminal protein-binding domain. Mutations in its gene can cause van der Woude syndrome and popliteal pterygium syndrome. This protein is involved in palate formation.

Molekulargewicht: 65 kDa (MW of target protein)