PRIM1 Antikörper (N-Term)

Produktnummer ABIN630190

Produktdetails anti-PRIM1 Antikörper

Target: PRIM1 (Primase, DNA, Polypeptide 1 (49kDa) (PRIM1))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PRIM1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PRIM1 antibody was raised against the N terminal of PRIM1

Aufreinigung: Purified

Immunogen: PRIM1 antibody was raised using the N terminal of PRIM1 corresponding to a region with amino acids SQYYRWLNYGGVIKNYFQHREFSFTLKDDIYIRYQSFNNQSDLEKEMQKM

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PRIM1 Blocking Peptide, catalog no. 33R-8737, is also available for use as a blocking control in assays to test for specificity of this PRIM1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRIM1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PRIM1

Target: PRIM1 (Primase, DNA, Polypeptide 1 (49kDa) (PRIM1))

Andere Bezeichnung: PRIM1 (PRIM1 Produkte)

Synonyme: AI324982 antikoerper, p49 antikoerper, dnapol-alpha50 antikoerper, DNA primase, p49 subunit antikoerper, DNA primase subunit 1 antikoerper, DNA primase subunit 1 S homeolog antikoerper, Prim1 antikoerper, PRIM1 antikoerper, prim1.S antikoerper

Hintergrund: The replication of DNA in eukaryotic cells is carried out by a complex chromosomal replication apparatus, in which DNA polymerase alpha and primase are two key enzymatic components. Primase, which is a heterodimer of a small subunit and a large subunit, synthesizes small RNA primers for the Okazaki fragments made during discontinuous DNA replication. PRIM1 is the small, 49 kDa primase subunit.

Molekulargewicht: 50 kDa (MW of target protein)

Pathways: Telomere Maintenance, Mitotic G1-G1/S Phases, DNA Replication, Synthesis of DNA, SARS-CoV-2 Protein Interaktom