KIF22 Antikörper (C-Term)

Produktnummer ABIN630189

Dieses Anti-KIF22-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von KIF22 in WB. Geeignet für Human.

Kurzübersicht für KIF22 Antikörper (C-Term) (ABIN630189)

Target: KIF22 (Kinesin Family Member 22 (KIF22))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KIF22 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-KIF22 Antikörper

Bindungsspezifität: C-Term

Spezifität: KIF22 antibody was raised against the C terminal of KIF22

Aufreinigung: Purified

Immunogen: KIF22 antibody was raised using the C terminal of KIF22 corresponding to a region with amino acids LASQGSQGAPLLSTPKRERMVLMKTVEEKDLEIERLKTKQKELEAKMLAQ

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KIF22 Blocking Peptide, (ABIN940184), is also available for use as a blocking control in assays to test for specificity of this KIF22 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIF22 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KIF22

Target: KIF22 (Kinesin Family Member 22 (KIF22))

Andere Bezeichnung: KIF22

Hintergrund: KIF22 a member of kinesin-like protein family. This family of proteins are microtubule-dependent molecular motors that transport organelles within cells and move chromosomes during cell division. The C-terminal half of this protein has been shown to bind DNA. Studies with the Xenopus homolog suggests its essential role in metaphase chromosome alignment and maintenance.

Molekulargewicht: 73 kDa (MW of target protein)