KIF1C Antikörper (C-Term)

Produktnummer ABIN630184

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch KIF1C in WB. Er zeigt eine Reaktivität gegenüber Human und Hund.

Kurzübersicht für KIF1C Antikörper (C-Term) (ABIN630184)

Target: KIF1C (Kinesin Family Member 1C (KIF1C))

Reaktivität: Human, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KIF1C Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-KIF1C Antikörper

Bindungsspezifität: C-Term

Spezifität: KIF1 C antibody was raised against the C terminal of KIF1

Aufreinigung: Purified

Immunogen: KIF1 C antibody was raised using the C terminal of KIF1 corresponding to a region with amino acids GGGRSRGAGSAQPEPQHFQPKKHNSYPQPPQPYPAQRPPGPRYPPYTTPP

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KIF1C Blocking Peptide, catalog no. 33R-3283, is also available for use as a blocking control in assays to test for specificity of this KIF1C antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIF0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KIF1C

Target: KIF1C (Kinesin Family Member 1C (KIF1C))

Andere Bezeichnung: KIF1C

Hintergrund: KIF1C represents a member of the Unc104 subfamily of kinesin-like proteins that are involved in the transport of mitochondria or synaptic vesicles in axons. KIF1C consists of an amino-terminal motor domain followed by a U104 domain and probably binds to target membranes through carboxyl-terminal sequences.

Molekulargewicht: 123 kDa (MW of target protein)