Asporin Antikörper (Middle Region)

Produktnummer ABIN630167

Der Kaninchen Polyklonal Anti-Asporin-Antikörper wurde für WB und IHC validiert. Er ist geeignet, Asporin in Proben von Human und Ratte zu detektieren.

Kurzübersicht für Asporin Antikörper (Middle Region) (ABIN630167)

Target: Asporin (ASPN)

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Asporin Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-Asporin Antikörper

Bindungsspezifität: Middle Region

Spezifität: Asporin antibody was raised against the middle region of ASPN

Aufreinigung: Purified

Immunogen: Asporin antibody was raised using the middle region of ASPN corresponding to a region with amino acids NKISTVELEDFKRYKELQRLGLGNNKITDIENGSLANIPRVREIHLENNK

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Asporin Blocking Peptide, (ABIN5612193), is also available for use as a blocking control in assays to test for specificity of this Asporin antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ASPN antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Asporin

Target: Asporin (ASPN)

Andere Bezeichnung: Asporin

Hintergrund: ASPN belongs to a family of leucine-rich repeat (LRR) proteins associated with the cartilage matrix. The name asporin reflects the unique aspartate-rich N terminus and the overall similarity to decorin.

Molekulargewicht: 42 kDa (MW of target protein)