HMGCL Antikörper

Produktnummer ABIN630162

Dieser Anti-HMGCL Antikörper ist ein Kaninchen Polyklonal Antikörper zur Detektion von HMGCL in WB. Geeignet für Human, Maus, Ratte und Hund.

Kurzübersicht für HMGCL Antikörper (ABIN630162)

Target: HMGCL (3-Hydroxymethyl-3-Methylglutaryl-CoA Lyase (HMGCL))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HMGCL Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-HMGCL Antikörper

Aufreinigung: Purified

Immunogen: HMGCL antibody was raised using a synthetic peptide corresponding to a region with amino acids WVPQMGDHTEVLKGIQKFPGINYPVLTPNLKGFEAAVAAGAKEVVIFGAA

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HMGCL Blocking Peptide, (ABIN935989), is also available for use as a blocking control in assays to test for specificity of this HMGCL antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HMGCL antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HMGCL

Target: HMGCL (3-Hydroxymethyl-3-Methylglutaryl-CoA Lyase (HMGCL))

Andere Bezeichnung: HMGCL

Hintergrund: The deficiency of HMGCL is related to an autosomal recessive branched chain organic aciduria.

Molekulargewicht: 36 kDa (MW of target protein)