SEMG1 Antikörper (N-Term)

Produktnummer ABIN630160

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch SEMG1 in WB und IHC. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für SEMG1 Antikörper (N-Term) (ABIN630160)

Target: SEMG1 (Semenogelin I (SEMG1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SEMG1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-SEMG1 Antikörper

Bindungsspezifität: N-Term

Spezifität: Semenogelin I antibody was raised against the N terminal of SEMG1

Aufreinigung: Purified

Immunogen: Semenogelin I antibody was raised using the N terminal of SEMG1 corresponding to a region with amino acids QKGKQQTESKGSFSIQYTYHVDANDHDQSRKSQQYDLNALHKTTKSQRHL

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Semenogelin I Blocking Peptide, (ABIN5616040), is also available for use as a blocking control in assays to test for specificity of this Semenogelin I antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SEMG1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SEMG1

Target: SEMG1 (Semenogelin I (SEMG1))

Andere Bezeichnung: Semenogelin I

Hintergrund: SEMG1 is the predominant protein in semen. The secreted protein is involved in the formation of a gel matrix that encases ejaculated spermatozoa. The prostate-specific antigen (PSA) protease processes this protein into smaller peptides, with each possibly having a separate function. The proteolysis process breaks down the gel matrix and allows the spermatozoa to move more freely.

Molekulargewicht: 51 kDa (MW of target protein)