Follistatin Antikörper (C-Term)
-
- Target Alle Follistatin (FST) Antikörper anzeigen
- Follistatin (FST)
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Maus, Ratte, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Follistatin Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- FST antibody was raised against the C terminal of FST
- Aufreinigung
- Purified
- Immunogen
- FST antibody was raised using the C terminal of FST corresponding to a region with amino acids SLCDELCPDSKSDEPVCASDNATYASECAMKEAACSSGVLLEVKHSGSCN
- Top Product
- Discover our top product FST Primärantikörper
-
-
- Applikationshinweise
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
FST Blocking Peptide, catalog no. 33R-8580, is also available for use as a blocking control in assays to test for specificity of this FST antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FST antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Follistatin (FST)
- Andere Bezeichnung
- FST (FST Produkte)
- Synonyme
- CG12955 antikoerper, CG12956 antikoerper, CG33466 antikoerper, Dmel\\CG33466 antikoerper, Fol1 antikoerper, dFS antikoerper, dFol1 antikoerper, dfs antikoerper, fs antikoerper, FS antikoerper, foll antikoerper, xfs antikoerper, FST antikoerper, fst antikoerper, AL033346 antikoerper, FOL1 antikoerper, Fst-288 antikoerper, RATFOL1 antikoerper, cb446 antikoerper, fd07h10 antikoerper, fst1 antikoerper, wu:fd07h10 antikoerper, Follistatin antikoerper, follistatin antikoerper, follistatin L homeolog antikoerper, follistatin a antikoerper, Fs antikoerper, fst antikoerper, FST antikoerper, LOC100141662 antikoerper, fst.L antikoerper, Fst antikoerper, fsta antikoerper
- Hintergrund
- Follistatin is a single-chain gonadal protein that specifically inhibits follicle-stimulating hormone release.Follistatin is a single-chain gonadal protein that specifically inhibits follicle-stimulating hormone release. The single FST gene encodes two isoforms, FST317 and FST344 containing 317 and 344 amino acids respectively, resulting from alternative splicing of the precursor mRNA. In a study in which 37 candidate genes were tested for linkage and association with polycystic ovary syndrome (PCOS) or hyperandrogenemia in 150 families, evidence was found for linkage between PCOS and follistatin.
- Molekulargewicht
- 35 kDa (MW of target protein)
- Pathways
- Negative Regulation of Hormone Secretion
-