Follistatin Antikörper (C-Term)

Produktnummer ABIN630158

Der Kaninchen Polyklonal Anti-Follistatin-Antikörper wurde für WB validiert. Er ist geeignet, Follistatin in Proben von Human, Maus, Ratte und Hund zu detektieren.

Kurzübersicht für Follistatin Antikörper (C-Term) (ABIN630158)

Target: Follistatin (FST)

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Follistatin Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Follistatin Antikörper

Bindungsspezifität: C-Term

Spezifität: FST antibody was raised against the C terminal of FST

Aufreinigung: Purified

Immunogen: FST antibody was raised using the C terminal of FST corresponding to a region with amino acids SLCDELCPDSKSDEPVCASDNATYASECAMKEAACSSGVLLEVKHSGSCN

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FST Blocking Peptide, catalog no. 33R-8580, is also available for use as a blocking control in assays to test for specificity of this FST antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FST antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Follistatin

Target: Follistatin (FST)

Andere Bezeichnung: FST

Hintergrund: Follistatin is a single-chain gonadal protein that specifically inhibits follicle-stimulating hormone release.Follistatin is a single-chain gonadal protein that specifically inhibits follicle-stimulating hormone release. The single FST gene encodes two isoforms, FST317 and FST344 containing 317 and 344 amino acids respectively, resulting from alternative splicing of the precursor mRNA. In a study in which 37 candidate genes were tested for linkage and association with polycystic ovary syndrome (PCOS) or hyperandrogenemia in 150 families, evidence was found for linkage between PCOS and follistatin.

Molekulargewicht: 35 kDa (MW of target protein)

Pathways: Negative Regulation of Hormone Secretion