PNLIP Antikörper (C-Term)

Produktnummer ABIN630156

Dieses Anti-PNLIP-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von PNLIP in WB. Geeignet für Human.

Kurzübersicht für PNLIP Antikörper (C-Term) (ABIN630156)

Target: PNLIP (Pancreatic Lipase (PNLIP))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PNLIP Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PNLIP Antikörper

Bindungsspezifität: C-Term

Spezifität: Lipase antibody (Pancreatic) was raised against the C terminal of PNLIP

Aufreinigung: Purified

Immunogen: Lipase antibody (Pancreatic) was raised using the C terminal of PNLIP corresponding to a region with amino acids SGKKVTGHILVSLFGNKGNSKQYEIFKGTLKPDSTHSNEFDSDVDVGDLQ

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Lipase Blocking Peptide (Pancreatic), catalog no. 33R-8469, is also available for use as a blocking control in assays to test for specificity of this Lipase antibody (Pancreatic)

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PNLIP antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PNLIP

Target: PNLIP (Pancreatic Lipase (PNLIP))

Andere Bezeichnung: Pancreatic Lipase

Hintergrund: PNLIP is a member of the lipase gene family. It encodes a carboxyl esterase that hydrolyzes insoluble, emulsified triglycerides, and is essential for the efficient digestion of dietary fats. This gene is expressed specifically in the pancreas.

Molekulargewicht: 51 kDa (MW of target protein)