PSG5 Antikörper (N-Term)

Produktnummer ABIN630155

Produktdetails anti-PSG5 Antikörper

Target: PSG5 (Pregnancy Specific beta-1-Glycoprotein 5 (PSG5))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PSG5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PSG5 antibody was raised against the N terminal of PSG5

Aufreinigung: Purified

Immunogen: PSG5 antibody was raised using the N terminal of PSG5 corresponding to a region with amino acids QLMDLYHYITSYVVDGQINIYGPAYTGRETVYSNASLLIQNVTREDAGSY

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PSG5 Blocking Peptide, catalog no. 33R-7634, is also available for use as a blocking control in assays to test for specificity of this PSG5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSG5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PSG5

Target: PSG5 (Pregnancy Specific beta-1-Glycoprotein 5 (PSG5))

Andere Bezeichnung: PSG5 (PSG5 Produkte)

Hintergrund: The pregnancy-specific beta 1 glycoprotein (PSG) is a group of heterogeneous proteins produced in large amounts by the human syncytiotrophoblast. They belong to the carcinoembryonic antigen (CEA) family. The function of PSG5 remains unknown.

Molekulargewicht: 37 kDa (MW of target protein)