Nucleobindin 1 Antikörper (C-Term)

Produktnummer ABIN630154

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch Nucleobindin 1 in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für Nucleobindin 1 Antikörper (C-Term) (ABIN630154)

Target: Nucleobindin 1 (NUCB1)

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Nucleobindin 1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Nucleobindin 1 Antikörper

Bindungsspezifität: C-Term

Spezifität: Nucleobindin 1 antibody was raised against the C terminal of NUCB1

Aufreinigung: Purified

Immunogen: Nucleobindin 1 antibody was raised using the C terminal of NUCB1 corresponding to a region with amino acids PAAHPEGQLKFHPDTDDVPVPAPAGDQKEVDTSEKKLLERLPEVEVPQHL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NUCB1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Nucleobindin 1

Target: Nucleobindin 1 (NUCB1)

Andere Bezeichnung: Nucleobindin 1

Hintergrund: Calnuc or NUCB1 belongs to the nucleobindin family. It is a major calcium-binding protein of the Golgi and is a good Golgi marker. It may be involved in calcium homeostasis. Calnuc also plays roles in regulation of levels of amyloid precursor protein (APP) and its proteolytic metabolites to further affect the patho/physiological functions of APP including Alzheimer's disease pathogenesis.

Molekulargewicht: 51 kDa (MW of target protein)