NUCB2 Antikörper (Middle Region)

Produktnummer ABIN630150

Produktdetails anti-NUCB2 Antikörper

Target: NUCB2 (Nucleobindin 2 (NUCB2))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NUCB2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: Nucleobindin 2 antibody was raised against the middle region of NUCB2

Aufreinigung: Purified

Immunogen: Nucleobindin 2 antibody was raised using the middle region of NUCB2 corresponding to a region with amino acids MMKEHERREYLKTLNEEKRKEEESKFEEMKKKHENHPKVNHPGSKDQLKE

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Nucleobindin 2 Blocking Peptide, catalog no. 33R-6232, is also available for use as a blocking control in assays to test for specificity of this Nucleobindin 2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NUCB2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NUCB2

Target: NUCB2 (Nucleobindin 2 (NUCB2))

Andere Bezeichnung: Nucleobindin 2 (NUCB2 Produkte)

Synonyme: nefa antikoerper, MGC97715 antikoerper, NUCB2 antikoerper, nucleobindin-2 antikoerper, NEFA antikoerper, AI607786 antikoerper, Calnuc antikoerper, Nefa antikoerper, Nesfatin-1 antikoerper, p54 antikoerper, nucleobindin 2 antikoerper, nucleobindin 2 L homeolog antikoerper, nucb2 antikoerper, NUCB2 antikoerper, Nucb2 antikoerper, nucb2.L antikoerper

Hintergrund: Nucleobindin-2 is a calcium-binding EF-hand protein.

Molekulargewicht: 46 kDa (MW of target protein)