NUCB2 Antikörper (Middle Region)

Produktnummer ABIN630150

Dieses Anti-NUCB2-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von NUCB2 in WB und IHC. Geeignet für Human.

Kurzübersicht für NUCB2 Antikörper (Middle Region) (ABIN630150)

Target: NUCB2 (Nucleobindin 2 (NUCB2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NUCB2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-NUCB2 Antikörper

Bindungsspezifität: Middle Region

Spezifität: Nucleobindin 2 antibody was raised against the middle region of NUCB2

Aufreinigung: Purified

Immunogen: Nucleobindin 2 antibody was raised using the middle region of NUCB2 corresponding to a region with amino acids MMKEHERREYLKTLNEEKRKEEESKFEEMKKKHENHPKVNHPGSKDQLKE

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Nucleobindin 2 Blocking Peptide, (ABIN5615077), is also available for use as a blocking control in assays to test for specificity of this Nucleobindin 2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NUCB2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NUCB2

Target: NUCB2 (Nucleobindin 2 (NUCB2))

Andere Bezeichnung: Nucleobindin 2

Hintergrund: Nucleobindin-2 is a calcium-binding EF-hand protein.

Molekulargewicht: 46 kDa (MW of target protein)