NUCB2 Antikörper (Middle Region)
-
- Target Alle NUCB2 Antikörper anzeigen
- NUCB2 (Nucleobindin 2 (NUCB2))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser NUCB2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- Nucleobindin 2 antibody was raised against the middle region of NUCB2
- Aufreinigung
- Purified
- Immunogen
- Nucleobindin 2 antibody was raised using the middle region of NUCB2 corresponding to a region with amino acids MMKEHERREYLKTLNEEKRKEEESKFEEMKKKHENHPKVNHPGSKDQLKE
- Top Product
- Discover our top product NUCB2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Nucleobindin 2 Blocking Peptide, catalog no. 33R-6232, is also available for use as a blocking control in assays to test for specificity of this Nucleobindin 2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NUCB2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NUCB2 (Nucleobindin 2 (NUCB2))
- Andere Bezeichnung
- Nucleobindin 2 (NUCB2 Produkte)
- Hintergrund
- Nucleobindin-2 is a calcium-binding EF-hand protein.
- Molekulargewicht
- 46 kDa (MW of target protein)
-