CST4 Antikörper (N-Term)
-
- Target Alle CST4 Antikörper anzeigen
- CST4 (Cystatin S (CST4))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CST4 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Cystatin S antibody was raised against the N terminal of CST4
- Aufreinigung
- Purified
- Immunogen
- Cystatin S antibody was raised using the N terminal of CST4 corresponding to a region with amino acids MARPLCTLLLLMATLAGALASSSKEENRIIPGGIYDADLNDEWVQRALHF
- Top Product
- Discover our top product CST4 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Cystatin S Blocking Peptide, catalog no. 33R-5732, is also available for use as a blocking control in assays to test for specificity of this Cystatin S antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CST4 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CST4 (Cystatin S (CST4))
- Andere Bezeichnung
- Cystatin S (CST4 Produkte)
- Hintergrund
- The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions. The protein is an S-type cystatin, based on its high level of expression in saliva, tears and seminal plasma. The specific role in these fluids is unclear but antibacterial and antiviral activity is present, consistent with a protective function.
- Molekulargewicht
- 16 kDa (MW of target protein)
-