SDF2 Antikörper (N-Term)

Produktnummer ABIN630142

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch SDF2 in WB und IHC. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für SDF2 Antikörper (N-Term) (ABIN630142)

Target: SDF2 (Stromal Cell Derived Factor 2 (SDF2))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SDF2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-SDF2 Antikörper

Bindungsspezifität: N-Term

Spezifität: SDF2 antibody was raised against the N terminal of SDF2

Aufreinigung: Purified

Immunogen: SDF2 antibody was raised using the N terminal of SDF2 corresponding to a region with amino acids KLLNTRHNVRLHSHDVRYGSGSGQQSVTGVTSVDDSNSYWRIRGKSATVC

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SDF2 Blocking Peptide, (ABIN939904), is also available for use as a blocking control in assays to test for specificity of this SDF2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SDF2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SDF2

Target: SDF2 (Stromal Cell Derived Factor 2 (SDF2))

Andere Bezeichnung: SDF2

Hintergrund: SDF2 is believed to be a secretory protein. It has regions of similarity to hydrophilic segments of yeast mannosyltransferases. Its expression is ubiquitous and the gene appears to be relatively conserved among mammals.

Molekulargewicht: 21 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interaktom