GOT2 Antikörper

Produktnummer ABIN630134

Produktdetails anti-GOT2 Antikörper

Target: GOT2 (Glutamic-Oxaloacetic Transaminase 2, Mitochondrial (Aspartate Aminotransferase 2) (GOT2))

Reaktivität: Human, Maus, Ratte, Zebrafisch (Danio rerio), Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GOT2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Purified

Immunogen: GOT2 antibody was raised using a synthetic peptide corresponding to a region with amino acids PPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLPSVRKAEAQIAA

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GOT2 Blocking Peptide, catalog no. 33R-7247, is also available for use as a blocking control in assays to test for specificity of this GOT2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GOT2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GOT2

Target: GOT2 (Glutamic-Oxaloacetic Transaminase 2, Mitochondrial (Aspartate Aminotransferase 2) (GOT2))

Andere Bezeichnung: GOT2 (GOT2 Produkte)

Synonyme: KAT4 antikoerper, KATIV antikoerper, mitAAT antikoerper, AI789014 antikoerper, Got-1 antikoerper, cAspAT antikoerper, cCAT antikoerper, AL022787 antikoerper, FABP-pm antikoerper, Got-2 antikoerper, mAspAT antikoerper, ASPATA antikoerper, got2 antikoerper, zgc:66329 antikoerper, fj40h07 antikoerper, wu:fj40h07 antikoerper, zgc:56425 antikoerper, glutamic-oxaloacetic transaminase 2 antikoerper, glutamic-oxaloacetic transaminase 1, soluble antikoerper, glutamatic-oxaloacetic transaminase 2, mitochondrial antikoerper, glutamic-oxaloacetic transaminase 2a, mitochondrial antikoerper, glutamic-oxaloacetic transaminase 2 L homeolog antikoerper, Aspartate amino transferase activity antikoerper, glutamic-oxaloacetic transaminase 2b, mitochondrial antikoerper, GOT2 antikoerper, got2 antikoerper, Got1 antikoerper, Got2 antikoerper, got2a antikoerper, got2.L antikoerper, AST antikoerper, got2b antikoerper

Hintergrund: Glutamic-oxaloacetic transaminase is a pyridoxal phosphate-dependent enzyme which exists in cytoplasmic and inner-membrane mitochondrial forms, GOT1 and GOT2, respectively. GOT plays a role in amino acid metabolism and the urea and tricarboxylic acid cycles. The two enzymes are homodimeric and show close homology.

Molekulargewicht: 45 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process